Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHES1 Rabbit Polyclonal Antibody (FITC)

CHES1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CHES1, PRO1635, C14orf116

UniProt

O00409

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CHES1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SGYASQHKKRQHFAKARKVPSDTLPLKKRRTEKPPESDDEEMKEAAGSLL

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005188

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

hsa-mir-142-5p RT-PCR Primer Set
abx096871 1 nmol

hsa-mir-142-5p RT-PCR Primer Set

Sign In for Pricing
View Details
Polyclonal Antibody to Tryptase Beta 2 (TPSb2)
MBS2028011-01 0.1 mL

Polyclonal Antibody to Tryptase Beta 2 (TPSb2)

Sign In for Pricing
View Details
Polyclonal Antibody to Tryptase Beta 2 (TPSb2)
MBS2028011-02 0.2 mL

Polyclonal Antibody to Tryptase Beta 2 (TPSb2)

Sign In for Pricing
View Details
Polyclonal Antibody to Tryptase Beta 2 (TPSb2)
MBS2028011-03 0.5 mL

Polyclonal Antibody to Tryptase Beta 2 (TPSb2)

Sign In for Pricing
View Details
Polyclonal Antibody to Tryptase Beta 2 (TPSb2)
MBS2028011-04 1 mL

Polyclonal Antibody to Tryptase Beta 2 (TPSb2)

Sign In for Pricing
View Details
Polyclonal Antibody to Tryptase Beta 2 (TPSb2)
MBS2028011-05 5 mL

Polyclonal Antibody to Tryptase Beta 2 (TPSb2)

Sign In for Pricing
View Details