Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHES1 Rabbit Polyclonal Antibody (HRP)

CHES1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CHES1, PRO1635, C14orf116

UniProt

O00409

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CHES1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SGYASQHKKRQHFAKARKVPSDTLPLKKRRTEKPPESDDEEMKEAAGSLL

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005188

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human NEDD8 ultimate buster 1/NUB1 (C-His)
BP2030-500ug 500 µg

Recombinant Human NEDD8 ultimate buster 1/NUB1 (C-His)

Sign In for Pricing
View Details
CD206/MRC1 Antibody [K13P18]
F4083-20uL 20 µL

CD206/MRC1 Antibody [K13P18]

Sign In for Pricing
View Details
Rabbit Nucleoporin 85kDa ELISA kit
GTR10379866 96 Well

Rabbit Nucleoporin 85kDa ELISA kit

Sign In for Pricing
View Details
Vta1 ORF Vector (Mouse) (pORF)
ORF061679 1.0 µg DNA

Vta1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
SYT4 Antibody
A68789-100UL 100 µL

SYT4 Antibody

Sign In for Pricing
View Details
PTX3 Antibody
A52464-100UL 100 µL

PTX3 Antibody

Sign In for Pricing
View Details