Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lzts1 Rabbit Polyclonal Antibody (FITC)

Lzts1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

F37, FEZ1, PSD-Z, PSD-Zip70

UniProt

P60853

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: HERLVWKEEKEKVIQYQRQLQQSYLAMYQRNQRLEKALQQLARGDGPGEP

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_955396

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human CRTAC1 sgRNA gene knockout kit - Lentiviral human CRTAC1 sgRNA gene knockout kit (25)
GTR15393576 1 Vial

Lentiviral human CRTAC1 sgRNA gene knockout kit - Lentiviral human CRTAC1 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
SLC25A38 Rabbit Polyclonal Antibody (BF680)
orb2465318 100 µL

SLC25A38 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
Escherichia coli, O157 Somatic Antigen (E. coli) (MaxLight 490)
E3500-02A-ML490 100 µL

Escherichia coli, O157 Somatic Antigen (E. coli) (MaxLight 490)

Sign In for Pricing
View Details
FECH Rabbit Polyclonal Antibody (Cy5)
orb877984 100 µL

FECH Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
Human RANK/TNFRSF11A MAb (Clone 80707)
MAB6831-SP 25 µg

Human RANK/TNFRSF11A MAb (Clone 80707)

Sign In for Pricing
View Details
FCGR3A, CT (FCGR3A, CD16A, FCG3, FCGR3, IGFR3, Low affinity immunoglobulin gamma Fc region receptor III-A, CD16a antigen, Fc-gamma RIII-alpha, FcR-10, IgG Fc receptor III-2, CD16a) (PE)
MBS6298669-01 0.2 mL

FCGR3A, CT (FCGR3A, CD16A, FCG3, FCGR3, IGFR3, Low affinity immunoglobulin gamma Fc region receptor III-A, CD16a antigen, Fc-gamma RIII-alpha, FcR-10, IgG Fc receptor III-2, CD16a) (PE)

Sign In for Pricing
View Details