Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zhx1 Rabbit Polyclonal Antibody (HRP)

Zhx1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KIAA4149, mKIAA4149, 3110006I21Rik

UniProt

P70121

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TGTAILKDYYLKHKFLNEQDLDELVNRSHMGYEQVREWFAERQRRSELGI

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

97kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_033598

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLP1 (NM_001128834) Human Tagged Lenti ORF Clone
RC225379L4 10 µg

PLP1 (NM_001128834) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Anti-SLC22A1 Rabbit Monoclonal Antibody
MBS1756908-01 0.03 mL

Anti-SLC22A1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-SLC22A1 Rabbit Monoclonal Antibody
MBS1756908-02 0.1 mL

Anti-SLC22A1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-SLC22A1 Rabbit Monoclonal Antibody
MBS1756908-03 5x 0.1 mL

Anti-SLC22A1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
ADAMTS13 Antibody, FITC conjugated
A11924-100UG 100 µg

ADAMTS13 Antibody, FITC conjugated

Sign In for Pricing
View Details
ADH4 Human qPCR Template Standard (NM_000670)
HK208368 1 Kit

ADH4 Human qPCR Template Standard (NM_000670)

Sign In for Pricing
View Details