Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zhx1 Rabbit Polyclonal Antibody (Biotin)

Zhx1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

KIAA4149, mKIAA4149, 3110006I21Rik

UniProt

P70121

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TGTAILKDYYLKHKFLNEQDLDELVNRSHMGYEQVREWFAERQRRSELGI

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

97kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_033598

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kinesin, Light Chain (FITC)
MBS6243332-01 0.1 mL

Kinesin, Light Chain (FITC)

Sign In for Pricing
View Details
Kinesin, Light Chain (FITC)
MBS6243332-02 5x 0.1 mL

Kinesin, Light Chain (FITC)

Sign In for Pricing
View Details
PCMV-CTDSPL (human) -3xFLAG-Neo
BZ55628 1 Vial

PCMV-CTDSPL (human) -3xFLAG-Neo

Sign In for Pricing
View Details
Mouse Protein canopy homolog 1, CNPY1 ELISA Kit
MBS9341232-01 48 Well

Mouse Protein canopy homolog 1, CNPY1 ELISA Kit

Sign In for Pricing
View Details
Mouse Protein canopy homolog 1, CNPY1 ELISA Kit
MBS9341232-02 96 Well

Mouse Protein canopy homolog 1, CNPY1 ELISA Kit

Sign In for Pricing
View Details
Mouse Protein canopy homolog 1, CNPY1 ELISA Kit
MBS9341232-03 5x 96 Well

Mouse Protein canopy homolog 1, CNPY1 ELISA Kit

Sign In for Pricing
View Details