Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLF12 Rabbit Polyclonal Antibody (HRP)

KLF12 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AP2REP, AP-2rep, HSPC122

UniProt

Q9Y4X4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KLF12

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MEAVPLLLNNVKGEPPEDSLSVDHFQTQTEPVDLSINKARTSPTAVSSSP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

EAW80528

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

cis-Terbinafine Hydrochloride
TRC-T107490-5MG 5 mg

cis-Terbinafine Hydrochloride

Sign In for Pricing
View Details
Rhobtb3 Mouse Gene Knockout Kit (CRISPR)
KN514767 1 Kit

Rhobtb3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TRIM32 (NM_001099679) Human Recombinant Protein
TP323796M 100 µg

TRIM32 (NM_001099679) Human Recombinant Protein

Sign In for Pricing
View Details
Cytokeratin 19 (KRT19) (Pancreatic Stem Cell Marker) (KRT19/1959R), CF647 conjugate, 0.1mg/mL
BNC471959-100 1x 100 µL

Cytokeratin 19 (KRT19) (Pancreatic Stem Cell Marker) (KRT19/1959R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nuclear Factor Erythroid Derived 2 (NFE2) (NM_006163) Human Over-expression Lysate
LC401856 20 µg

Nuclear Factor Erythroid Derived 2 (NFE2) (NM_006163) Human Over-expression Lysate

Sign In for Pricing
View Details
ZNF331 Rabbit Polyclonal Antibody
TA383551 100 µL

ZNF331 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details