Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLF12 Rabbit Polyclonal Antibody (Biotin)

KLF12 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AP2REP, AP-2rep, HSPC122

UniProt

Q9Y4X4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KLF12

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MEAVPLLLNNVKGEPPEDSLSVDHFQTQTEPVDLSINKARTSPTAVSSSP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

EAW80528

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC680787 3'UTR Luciferase Stable Cell Line
TU210683 1.0 mL

LOC680787 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rat Interleukin 2 (IL2) Antibody Pair Kit (with Standard)
MBS2089663-01 5x 96 Tests

Rat Interleukin 2 (IL2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rat Interleukin 2 (IL2) Antibody Pair Kit (with Standard)
MBS2089663-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Rat Interleukin 2 (IL2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rat Interleukin 2 (IL2) Antibody Pair Kit (with Standard)
MBS2089663-03 10x 96 Tests

Rat Interleukin 2 (IL2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rat Interleukin 2 (IL2) Antibody Pair Kit (with Standard)
MBS2089663-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Rat Interleukin 2 (IL2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
HIV2 gp36 Rabbit Polyclonal Antibody (Biotin)
orb446092 100 µL

HIV2 gp36 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details