Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nr0b1 Rabbit Polyclonal Antibody (Biotin)

Nr0b1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AH, AHX, Ahc, Dax, Ahch, DAX-, Dax1, DAX-1

UniProt

Q61066

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Nr0b1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YIEGLQWRTQQILTEHIRMMQREYQIRSAELNSALFLLRFINSDVVTELF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_031456

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SRRM1 (Serine/Arginine Repetitive Matrix 1, 160-KD, POP101, SRM160) discontinued
213569-01 20 µL

SRRM1 (Serine/Arginine Repetitive Matrix 1, 160-KD, POP101, SRM160) discontinued

Sign In for Pricing
View Details
SRRM1 (Serine/Arginine Repetitive Matrix 1, 160-KD, POP101, SRM160) discontinued
213569-02 100 µL

SRRM1 (Serine/Arginine Repetitive Matrix 1, 160-KD, POP101, SRM160) discontinued

Sign In for Pricing
View Details
Mouse TNNT1 (Troponin T Type 1, Slow Skeletal) ELISA Kit
MBS8805887-01 48 Well

Mouse TNNT1 (Troponin T Type 1, Slow Skeletal) ELISA Kit

Sign In for Pricing
View Details
Mouse TNNT1 (Troponin T Type 1, Slow Skeletal) ELISA Kit
MBS8805887-02 96 Well

Mouse TNNT1 (Troponin T Type 1, Slow Skeletal) ELISA Kit

Sign In for Pricing
View Details
Mouse TNNT1 (Troponin T Type 1, Slow Skeletal) ELISA Kit
MBS8805887-03 5x 96 Well

Mouse TNNT1 (Troponin T Type 1, Slow Skeletal) ELISA Kit

Sign In for Pricing
View Details
Mouse TNNT1 (Troponin T Type 1, Slow Skeletal) ELISA Kit
MBS8805887-04 10x 96 Well

Mouse TNNT1 (Troponin T Type 1, Slow Skeletal) ELISA Kit

Sign In for Pricing
View Details