Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZBTB7C Rabbit Polyclonal Antibody (FITC)

ZBTB7C Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

APM1, APM-1, ZBTB36, ZNF857C

UniProt

O73453

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZBTB7C

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MANDIDELIGIPFPNHSSEVLCSLNEQRHDGLLCDVLLVVQEQEYRTHRS

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

69kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001034449

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Colon
CS703982 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
4-(2-Acetoxyacetyl)phenyl Acetate
TRC-A167685-500MG 500 mg

4-(2-Acetoxyacetyl)phenyl Acetate

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: right
CS628439 5x 5 µm

Frozen Tissue Sections, Ovary: right

Sign In for Pricing
View Details
Endothelium Mouse Monoclonal Antibody [Clone ID: OX-43]
CL116FX 500 µg

Endothelium Mouse Monoclonal Antibody [Clone ID: OX-43]

Sign In for Pricing
View Details
Mouse SEPP1 (Selenoprotein P) ELISA Kit
E-EL-M3044-01 24 Tests

Mouse SEPP1 (Selenoprotein P) ELISA Kit

Sign In for Pricing
View Details
Mouse SEPP1 (Selenoprotein P) ELISA Kit
E-EL-M3044-02 48 Tests

Mouse SEPP1 (Selenoprotein P) ELISA Kit

Sign In for Pricing
View Details