Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZBTB7C Rabbit Polyclonal Antibody (HRP)

ZBTB7C Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

APM1, APM-1, ZBTB36, ZNF857C

UniProt

O73453

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZBTB7C

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MANDIDELIGIPFPNHSSEVLCSLNEQRHDGLLCDVLLVVQEQEYRTHRS

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

69kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001034449

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CXCL16 Polyclonal Antibody
AN006900L-01 25 µL

CXCL16 Polyclonal Antibody

Sign In for Pricing
View Details
CXCL16 Polyclonal Antibody
AN006900L-02 100 µL

CXCL16 Polyclonal Antibody

Sign In for Pricing
View Details
Emerin (EMD) (NM_000117) Human Over-expression Lysate
LY400039 100 µg

Emerin (EMD) (NM_000117) Human Over-expression Lysate

Sign In for Pricing
View Details
FAM157A Human Gene Knockout Kit (CRISPR)
KN426948 1 Kit

FAM157A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
P21WAF1 (Tumor Suppressor Protein) (CIP1/2275R), 1mg/mL
BNUM2275-50 1x 50 µL

P21WAF1 (Tumor Suppressor Protein) (CIP1/2275R), 1mg/mL

Sign In for Pricing
View Details
FDX2 (NM_001031734) Human Over-expression Lysate
LY422180 100 µg

FDX2 (NM_001031734) Human Over-expression Lysate

Sign In for Pricing
View Details