Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hes6 Rabbit Polyclonal Antibody (HRP)

Hes6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BHLHb4, bHLHb41, AI326893

UniProt

Q9JHE6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Hes6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LLAGTEVQAKLENAEVLELTVRRVQGALRGRAREREQLQAEASERFAAGY

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_062352

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human glucose 6 phosphatase, catalytic subunit (G6PC) activation kit by CRISPRa
GA101686 1 Kit

Human glucose 6 phosphatase, catalytic subunit (G6PC) activation kit by CRISPRa

Sign In for Pricing
View Details
FITC Anti-Mouse CD5 Antibody[53-7.3]
E-AB-F1185UC-01 25 µg

FITC Anti-Mouse CD5 Antibody[53-7.3]

Sign In for Pricing
View Details
FITC Anti-Mouse CD5 Antibody[53-7.3]
E-AB-F1185UC-02 100 µg

FITC Anti-Mouse CD5 Antibody[53-7.3]

Sign In for Pricing
View Details
Fibroblast activation protein, alpha (FAP) (NM_004460) Human Over-expression Lysate
LY401418 100 µg

Fibroblast activation protein, alpha (FAP) (NM_004460) Human Over-expression Lysate

Sign In for Pricing
View Details
THRSP (NM_003251) Human Over-expression Lysate
LY401120 100 µg

THRSP (NM_003251) Human Over-expression Lysate

Sign In for Pricing
View Details
Human IL-17A (Interleukin 17A) solid ELISPOT Kit
ESP-H0004S-01 96 Tests

Human IL-17A (Interleukin 17A) solid ELISPOT Kit

Sign In for Pricing
View Details