Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIF1AN Rabbit Polyclonal Antibody (HRP)

HIF1AN Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FIH1

UniProt

Q9NWT6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HIF1AN

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTN

Field of Research

Metabolism Research

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060372

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fresolimumab Biosimilar - Research Grade
ICH5077-1mg 1 mg

Fresolimumab Biosimilar - Research Grade

Sign In for Pricing
View Details
Acid Blue 9 (Technical Grade)
TRC-A189815-50MG 50 mg

Acid Blue 9 (Technical Grade)

Sign In for Pricing
View Details
RPAIN Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E6]
TA810498AM 100 µL

RPAIN Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E6]

Sign In for Pricing
View Details
Mrps26 (NM_207207) Mouse Tagged ORF Clone
MG202037 10 µg

Mrps26 (NM_207207) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CT47A10 Human Gene Knockout Kit (CRISPR)
KN422313 1 Kit

CT47A10 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IL 10 Rat
OM296762-01 10 µg

IL 10 Rat

Sign In for Pricing
View Details