Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C14ORF131 Rabbit Polyclonal Antibody (HRP)

C14ORF131 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C14orf131

UniProt

Q9Y595

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C14ORF131

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KMCQDYLSSSGLCSQETLEINNDKVAESLGITEFLRKKEIHPDNLGPKHL

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_060805

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Envoplakin (EVPL) activation kit by CRISPRa
GA101482 1 Kit

Human Envoplakin (EVPL) activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: right
CS800360 5x 5 µm

Tissue FFPE Sections, Ovary: right

Sign In for Pricing
View Details
FIGNL1 (NM_001042762) Human Over-expression Lysate
LY420807 100 µg

FIGNL1 (NM_001042762) Human Over-expression Lysate

Sign In for Pricing
View Details
PLEKHB2 (NM_001031706) Human Over-expression Lysate
LY422159 100 µg

PLEKHB2 (NM_001031706) Human Over-expression Lysate

Sign In for Pricing
View Details
Porcine Vascular Endothelial Growth Factor Receptor 2 (VEGFR2) ELISA Kit
RD-VEGFR2-p-01 96 Tests

Porcine Vascular Endothelial Growth Factor Receptor 2 (VEGFR2) ELISA Kit

Sign In for Pricing
View Details
Porcine Vascular Endothelial Growth Factor Receptor 2 (VEGFR2) ELISA Kit
RD-VEGFR2-p-02 48 Tests

Porcine Vascular Endothelial Growth Factor Receptor 2 (VEGFR2) ELISA Kit

Sign In for Pricing
View Details