Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOXJ2 Rabbit Polyclonal Antibody (FITC)

FOXJ2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FHX

UniProt

Q9P0K8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FOXJ2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SLQSPTSIASYSQGTGSVDGGAVAAGASGRESAEGPPPLYNTNHDFKFSY

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_060886

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tert-Butyl 3- (2-methylpropyl) -4-oxopiperidine-1-carboxylate
ATC13635-01 50 mg

Tert-Butyl 3- (2-methylpropyl) -4-oxopiperidine-1-carboxylate

Sign In for Pricing
View Details
Tert-Butyl 3- (2-methylpropyl) -4-oxopiperidine-1-carboxylate
ATC13635-02 0.5 g

Tert-Butyl 3- (2-methylpropyl) -4-oxopiperidine-1-carboxylate

Sign In for Pricing
View Details
Anti-TMF Rabbit Monoclonal Antibody
M02214 100 µL/Vial

Anti-TMF Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
ERBB2, phosphorylated (T1172) (ERBB2, HER2, MLN19, NEU, NGL, Receptor tyrosine-protein kinase erbB-2, Metastatic lymph node gene 19 protein, Proto-oncogene Neu, Proto-oncogene c-ErbB-2, Tyrosine kinase-type cell surface receptor HER2, p185erbB2, CD340) (Azide free) (HRP) discontinued
035177-HRP 200 µL

ERBB2, phosphorylated (T1172) (ERBB2, HER2, MLN19, NEU, NGL, Receptor tyrosine-protein kinase erbB-2, Metastatic lymph node gene 19 protein, Proto-oncogene Neu, Proto-oncogene c-ErbB-2, Tyrosine kinase-type cell surface receptor HER2, p185erbB2, CD340) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
CENPC1 sgRNA CRISPR Lentivector set (Human)
K0431801 3x 1.0 µg

CENPC1 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
BMS-309403 sodium
orb1686688-01 5 mg

BMS-309403 sodium

Sign In for Pricing
View Details