Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pollen allergen Phl p 5b, Phleum pratense (His-SUMO)

Pollen allergen Phl p 5b protein, with ribonuclease activity, is speculated to participate in host-pathogen interactions. Its structural configuration involves a homodimer linked by disulfide bonds, highlighting its molecular arrangement in cellular processes. Pollen allergen Phl p 5b Protein, Phleum pratense (His-SUMO) is the recombinant Pollen allergen Phl p 5b protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Pollen allergen Phl p 5b Protein, Phleum pratense (His-SUMO), Others, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pollen-allergen-phl-p-5b-protein-phleum-pratense-his-sumo.html

Smiles

ADAGYAPATPAAAGAAAGKATTEEQKLIEDINVGFKAAVAAAASVPAADKFKTFEAAFTSSSKAAAAKAPGLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQPATGAATVAAGAATTAAGAASGAATVAAGGYKV

Molecular Formula

/ (Gene_ID) Q40963 (A20-V284) (Accession)

Molecular Weight

Approximately 42.1 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 (PAb122), CF640R conjugate, 0.1mg/mL
BNC400338-100 1x 100 µL

P53 (PAb122), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF740 conjugate, 0.1mg/mL
BNC740338-100 1x 100 µL

P53 (PAb122), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PS2 (GE2), CF740 conjugate, 0.1mg/mL
BNC740677-500 1x 500 µL

PS2 (GE2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD99 (MIC2/877), CF594 conjugate, 0.1mg/mL
BNC940877-100 1x 100 µL

CD99 (MIC2/877), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details