Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hps3 Rabbit Polyclonal Antibody (HRP)

Hps3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Hps3

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Rat

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LSRQRCTFSTLGRVLRMAYSEAGDYLVAIEEKNKTVFLRAYVNWRSKRND

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

113kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001101134

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMPD4P2 Protein Vector (Human) (pPM-C-His)
PV130465 500 ng

SMPD4P2 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
INT11 (CPSF3L) Rabbit Polyclonal Antibody
TA331879 100 µL

INT11 (CPSF3L) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Corynebacterium diphtheriae Chaperone protein DnaK (dnaK), partial
MBS1448684 Inquire

Recombinant Corynebacterium diphtheriae Chaperone protein DnaK (dnaK), partial

Sign In for Pricing
View Details
Rabbit Monoclonal EN-RAGE/S100A12 Antibody (133)
NBP2-89816-50ul 50 µL

Rabbit Monoclonal EN-RAGE/S100A12 Antibody (133)

Sign In for Pricing
View Details
PL6 Polyclonal Antibody, Cy3 Conjugated
bs-13697R-Cy3 100 µL

PL6 Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
NRG2 Protein Vector (Human) (pPB-N-His)
PV105063 500 ng

NRG2 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details