Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hps3 Rabbit Polyclonal Antibody (HRP)

Hps3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Hps3

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Rat

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LSRQRCTFSTLGRVLRMAYSEAGDYLVAIEEKNKTVFLRAYVNWRSKRND

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

113kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001101134

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBE1L / UBE2 Rabbit Polyclonal Antibody (BF488)
orb2427015 100 µL

UBE1L / UBE2 Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
NF-kB p100 / p52 (pS865) Antibody
abx011251 100 µg

NF-kB p100 / p52 (pS865) Antibody

Sign In for Pricing
View Details
SDF-1 Rabbit Polyclonal Antibody
E53P05814 100 µL

SDF-1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LIM Kinase 1 (LIMK1) Mouse Monoclonal Antibody [Clone ID: OTI6A7]
TA502974 100 µL

LIM Kinase 1 (LIMK1) Mouse Monoclonal Antibody [Clone ID: OTI6A7]

Sign In for Pricing
View Details
ZBTB24 Protein Lysate (Rat) with C-HA Tag
50697036 100 µg

ZBTB24 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Biliverdin reductase A protein
30R-1377 100 ug

Biliverdin reductase A protein

Sign In for Pricing
View Details