Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAF15 Rabbit Polyclonal Antibody (HRP)

TAF15 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Npl3, RBP56, TAF2N, TAFII68

UniProt

Q92804

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TAF15

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GGRGRGGYDKDGRGPMTGSSGGDRGGFKNFGGHRDYGPRTDADSESDNSD

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_631961

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TE Buffer 10X, Liquid Concentrate
10530029-4 1 L

TE Buffer 10X, Liquid Concentrate

Sign In for Pricing
View Details
Ott CRISPRa sgRNA lentivector (set of three targets)(Mouse)
35815124 3x 1.0µg DNA

Ott CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
VASP, phosphorylated (S157) (Vasodilator Stimulated Phosphoprotein)
329411-01 50 µg

VASP, phosphorylated (S157) (Vasodilator Stimulated Phosphoprotein)

Sign In for Pricing
View Details
VASP, phosphorylated (S157) (Vasodilator Stimulated Phosphoprotein)
329411-02 100 µg

VASP, phosphorylated (S157) (Vasodilator Stimulated Phosphoprotein)

Sign In for Pricing
View Details
Anti-Histone H3.3 Antibody (3Z104)
TMAB-07132-01 50 μL

Anti-Histone H3.3 Antibody (3Z104)

Sign In for Pricing
View Details
Anti-Histone H3.3 Antibody (3Z104)
TMAB-07132-02 100 µL

Anti-Histone H3.3 Antibody (3Z104)

Sign In for Pricing
View Details