Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEACAM5 Rabbit Polyclonal Antibody (FITC)

CEACAM5 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CEA, CD66e

UniProt

P06731

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human CEAM5

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKE

Field of Research

Cell Biology

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

77kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_004354

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLV2-CMV-Usp16-Puro Plasmid
PVT71458 2 µg

PLV2-CMV-Usp16-Puro Plasmid

Sign In for Pricing
View Details
Lentiviral human IKBKE shRNA (UAS) - Lentiviral human IKBKE shRNA (UAS, GFP) (100)
GTR15308424 1 Vial

Lentiviral human IKBKE shRNA (UAS) - Lentiviral human IKBKE shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
SMARCAD1 Antibody Blocking Peptide
orb1507836 500 µg

SMARCAD1 Antibody Blocking Peptide

Sign In for Pricing
View Details
SH3RF2, ID (SH3RF2, PPP1R39, RNF158, Putative E3 ubiquitin-protein ligase SH3RF2, Heart protein phosphatase 1-binding protein, Protein phosphatase 1 regulatory subunit 39, RING finger protein 158, SH3 domain-containing RING finger protein 2) (Biotin)
MBS6347287-01 0.2 mL

SH3RF2, ID (SH3RF2, PPP1R39, RNF158, Putative E3 ubiquitin-protein ligase SH3RF2, Heart protein phosphatase 1-binding protein, Protein phosphatase 1 regulatory subunit 39, RING finger protein 158, SH3 domain-containing RING finger protein 2) (Biotin)

Sign In for Pricing
View Details
SH3RF2, ID (SH3RF2, PPP1R39, RNF158, Putative E3 ubiquitin-protein ligase SH3RF2, Heart protein phosphatase 1-binding protein, Protein phosphatase 1 regulatory subunit 39, RING finger protein 158, SH3 domain-containing RING finger protein 2) (Biotin)
MBS6347287-02 5x 0.2 mL

SH3RF2, ID (SH3RF2, PPP1R39, RNF158, Putative E3 ubiquitin-protein ligase SH3RF2, Heart protein phosphatase 1-binding protein, Protein phosphatase 1 regulatory subunit 39, RING finger protein 158, SH3 domain-containing RING finger protein 2) (Biotin)

Sign In for Pricing
View Details
Cyanine 3 Bisfunctional MTSEA Dye (potassium)
HY-D1414 1 Each

Cyanine 3 Bisfunctional MTSEA Dye (potassium)

Sign In for Pricing
View Details