Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STK17B Rabbit Polyclonal Antibody (HRP)

STK17B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DRAK2

UniProt

Q53QE7

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human STK17B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SSQTQDHSVRSSEDKTSKSSCNGTCGDREDKENIPEDSSMVSKRFRFDDS

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_004217

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Horse Calcitonin, CALCA ELISA Kit
MBS1611130-01 48 Well

Horse Calcitonin, CALCA ELISA Kit

Sign In for Pricing
View Details
Horse Calcitonin, CALCA ELISA Kit
MBS1611130-02 96 Well

Horse Calcitonin, CALCA ELISA Kit

Sign In for Pricing
View Details
Horse Calcitonin, CALCA ELISA Kit
MBS1611130-03 5x 96 Well

Horse Calcitonin, CALCA ELISA Kit

Sign In for Pricing
View Details
Horse Calcitonin, CALCA ELISA Kit
MBS1611130-04 10x 96 Well

Horse Calcitonin, CALCA ELISA Kit

Sign In for Pricing
View Details
IQCF6 (IQ Domain-Containing Protein F6, IQCF6) (MaxLight 650)
MBS6456687-01 0.1 mL

IQCF6 (IQ Domain-Containing Protein F6, IQCF6) (MaxLight 650)

Sign In for Pricing
View Details
IQCF6 (IQ Domain-Containing Protein F6, IQCF6) (MaxLight 650)
MBS6456687-02 5x 0.1 mL

IQCF6 (IQ Domain-Containing Protein F6, IQCF6) (MaxLight 650)

Sign In for Pricing
View Details