Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ID1 Rabbit Polyclonal Antibody (HRP)

ID1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ID, bHLHb24

UniProt

P41134

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human ID1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVG

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (R1/69), CF488A conjugate, 0.1mg/mL
BNC882096-100 1x 100 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (R1/69), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD103 / Integrin alpha E (T-Cell Lymphoma & Hairy Cell Leukemia Marker) (ITGAE/2474), Biotin conjugate, 0.1mg/mL
BNCB2474-500 1x 500 µL

CD103 / Integrin alpha E (T-Cell Lymphoma & Hairy Cell Leukemia Marker) (ITGAE/2474), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (CC49), CF594 conjugate, 0.1mg/mL
BNC940732-100 1x 100 µL

TAG-72 / CA72.4 (CC49), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Milk Fat Globulin (EDM45), CF640R conjugate, 0.1mg/mL
BNC400942-500 1x 500 µL

Milk Fat Globulin (EDM45), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ADH4 Polyclonal Antibody
E-AB-68370-01 60 µL

ADH4 Polyclonal Antibody

Sign In for Pricing
View Details
ADH4 Polyclonal Antibody
E-AB-68370-02 120 µL

ADH4 Polyclonal Antibody

Sign In for Pricing
View Details