Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pdcd2 Rabbit Polyclonal Antibody (FITC)

Pdcd2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

P47816

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Pdcd2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AGLRVFRNQLPRKNAFYSYEPPSETGASDTECVCLQLKSGAHLCRVCGCL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_113826

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin B1/CCNB1 Rabbit Polyclonal Antibody (Fluoro594)
orb3117018 100 µg

Cyclin B1/CCNB1 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
DNTT (DNA Nucleotidylexotransferase, Terminal Addition Enzyme, Terminal Deoxynucleotidyltransferase, Terminal Transferase, TDT) (MaxLight 650)
125978-ML650 100 µL

DNTT (DNA Nucleotidylexotransferase, Terminal Addition Enzyme, Terminal Deoxynucleotidyltransferase, Terminal Transferase, TDT) (MaxLight 650)

Sign In for Pricing
View Details
Lentiviral mouse Prep shRNA (UAS) - Lentiviral mouse Prep shRNA (UAS, RFP) plasmid
GTR15232621 1 Vial

Lentiviral mouse Prep shRNA (UAS) - Lentiviral mouse Prep shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
PBK (Lymphokine-activated Killer T-cell-originated Protein Kinase, Cancer/Testis Antigen 84, CT84, MAPKK-like Protein Kinase, Nori-3, PDZ-binding Kinase, Spermatogenesis-related Protein Kinase, SPK, T-LAK Cell-originated Protein Kinase, TOPK, FLJ14385) (MaxLight 405) discontinued
130917-ML405 100 µL

PBK (Lymphokine-activated Killer T-cell-originated Protein Kinase, Cancer/Testis Antigen 84, CT84, MAPKK-like Protein Kinase, Nori-3, PDZ-binding Kinase, Spermatogenesis-related Protein Kinase, SPK, T-LAK Cell-originated Protein Kinase, TOPK, FLJ14385) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Anti-HE4/WFDC2 Antibody Picoband® (Cy3 Conjugate)
PB9963-Cy3 100 µg/Vial

Anti-HE4/WFDC2 Antibody Picoband® (Cy3 Conjugate)

Sign In for Pricing
View Details
KRT27 siRNA (Rat)
MBS8225103-01 15 nmol

KRT27 siRNA (Rat)

Sign In for Pricing
View Details