Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pdcd2 Rabbit Polyclonal Antibody (FITC)

Pdcd2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

P47816

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Pdcd2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AGLRVFRNQLPRKNAFYSYEPPSETGASDTECVCLQLKSGAHLCRVCGCL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_113826

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Lrpap1 Pre-designed siRNA Set B
SI207788B 1 Each

Rat Lrpap1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Canine Olfactory receptor 52E2 (OR52E2) ELISA Kit
MBS7204200-01 48 Well

Canine Olfactory receptor 52E2 (OR52E2) ELISA Kit

Sign In for Pricing
View Details
Canine Olfactory receptor 52E2 (OR52E2) ELISA Kit
MBS7204200-02 96 Well

Canine Olfactory receptor 52E2 (OR52E2) ELISA Kit

Sign In for Pricing
View Details
Canine Olfactory receptor 52E2 (OR52E2) ELISA Kit
MBS7204200-03 5x 96 Well

Canine Olfactory receptor 52E2 (OR52E2) ELISA Kit

Sign In for Pricing
View Details
Canine Olfactory receptor 52E2 (OR52E2) ELISA Kit
MBS7204200-04 10x 96 Well

Canine Olfactory receptor 52E2 (OR52E2) ELISA Kit

Sign In for Pricing
View Details
TYROBP, CT (TYROBP, DAP12, KARAP, TYRO protein tyrosine kinase-binding protein, DNAX-activation protein 12, Killer-activating receptor-associated protein) (Biotin)
043490-Biotin 200 µL

TYROBP, CT (TYROBP, DAP12, KARAP, TYRO protein tyrosine kinase-binding protein, DNAX-activation protein 12, Killer-activating receptor-associated protein) (Biotin)

Sign In for Pricing
View Details