Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pax7 Rabbit Polyclonal Antibody (HRP)

Pax7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RGD1564360

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human Pax7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SDVESEPDLPLKRKQRRSRTTFTAEQLEELEKAFERTHYPDIYTREELAQ

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IF, WB

NCBI Accession Number

NP_001178913

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTH (Adrenocorticotrophic Hormone) (N-Terminal) (Pituitary Marker) (r57), CF488A conjugate, 0.1mg/mL
BNC881380-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (N-Terminal) (Pituitary Marker) (r57), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NFYA (NM_002505) Human Over-expression Lysate
LY400893 100 µg

NFYA (NM_002505) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS705618 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
TAFA1 (NM_213609) Human Over-expression Lysate
LC403887 20 µg

TAFA1 (NM_213609) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS646839 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Fmoc-hydrazino TentaGel® TRT Resin
S30070.5G 5 g

Fmoc-hydrazino TentaGel® TRT Resin

Sign In for Pricing
View Details