Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBL1 Rabbit Polyclonal Antibody (FITC)

RBL1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PRB1, p107, CP107

UniProt

P28749

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence NMIRQGEQRTKKRVIAIDSDAESPAKRVCQENDDVLLKRLQDVVSERANH

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NMIRQGEQRTKKRVIAIDSDAESPAKRVCQENDDVLLKRLQDVVSERANH

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

121 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

NCBI Accession Number

NP_002886

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Hu CD45RB Purified
11-224-C100 0.1 mg

Anti-Hu CD45RB Purified

Sign In for Pricing
View Details
DHX36 Rabbit pAb
E45R25675N 50 ul

DHX36 Rabbit pAb

Sign In for Pricing
View Details
OLR1147 Adenovirus (Rat)
33705056 1.0 mL

OLR1147 Adenovirus (Rat)

Sign In for Pricing
View Details
Lupeol 100mg
A13951-100 100 mg

Lupeol 100mg

Sign In for Pricing
View Details
Gm14135 Mouse siRNA Oligo Duplex (Locus ID 433483)
SR404167 1 Kit

Gm14135 Mouse siRNA Oligo Duplex (Locus ID 433483)

Sign In for Pricing
View Details
5- (2,6-Difluorophenyl) -1,3,4-thiadiazol-2-amine
ZLA93369-01 250 mg

5- (2,6-Difluorophenyl) -1,3,4-thiadiazol-2-amine

Sign In for Pricing
View Details