Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NR3C1 Rabbit Polyclonal Antibody (FITC)

NR3C1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

GR, GCR, GRL, GCCR, GCRST

UniProt

P04150

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NR3C1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MDSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAV

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

86kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

IHC, WB

NCBI Accession Number

NP_001018086

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kappa Light Chain (HCAK1, Ig kappa Chain C Region, IGKC, Immunoglobulin kappa Constant Region, Immunoglobulin kappa Light Chain, Kappa 1 Immunoglobulin Light Chain, Km, MGC111575, MGC62011, MGC72072, MGC88770, MGC88771, MGC88809) (AP) discontinued
128719-AP 100 µL

Kappa Light Chain (HCAK1, Ig kappa Chain C Region, IGKC, Immunoglobulin kappa Constant Region, Immunoglobulin kappa Light Chain, Kappa 1 Immunoglobulin Light Chain, Km, MGC111575, MGC62011, MGC72072, MGC88770, MGC88771, MGC88809) (AP) discontinued

Sign In for Pricing
View Details
EPHA1 Protein (N-His, Human)
P503627 100 µg

EPHA1 Protein (N-His, Human)

Sign In for Pricing
View Details
PLEKHO2 (PP9099, PLEKHQ1, Pleckstrin Homology Domain-containing Family O Member 2, PH Domain-containing Family O Member 2, Pleckstrin Homology Domain-containing Family Q Member 1, PH Domain-containing Family Q Member 1) (PE)
MBS6389778-01 0.1 mL

PLEKHO2 (PP9099, PLEKHQ1, Pleckstrin Homology Domain-containing Family O Member 2, PH Domain-containing Family O Member 2, Pleckstrin Homology Domain-containing Family Q Member 1, PH Domain-containing Family Q Member 1) (PE)

Sign In for Pricing
View Details
PLEKHO2 (PP9099, PLEKHQ1, Pleckstrin Homology Domain-containing Family O Member 2, PH Domain-containing Family O Member 2, Pleckstrin Homology Domain-containing Family Q Member 1, PH Domain-containing Family Q Member 1) (PE)
MBS6389778-02 5x 0.1 mL

PLEKHO2 (PP9099, PLEKHQ1, Pleckstrin Homology Domain-containing Family O Member 2, PH Domain-containing Family O Member 2, Pleckstrin Homology Domain-containing Family Q Member 1, PH Domain-containing Family Q Member 1) (PE)

Sign In for Pricing
View Details
Protein CREG2 (CREG2) Human ELISA Kit
G2603 96 Tests

Protein CREG2 (CREG2) Human ELISA Kit

Sign In for Pricing
View Details
NDUA6 Polyclonal Antibody
RA33505-01 50 µL

NDUA6 Polyclonal Antibody

Sign In for Pricing
View Details