Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pax2 Rabbit Polyclonal Antibody (FITC)

Pax2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Op, Pax, Opdc, Pax-2

UniProt

P32114

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: HIKSEQGNEYSLPALTPGLDEVKSSLSASANPELGSNVSGTQTYPVVTGR

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_035167

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Prodh2 shRNA (UAS) - Lentiviral mouse Prodh2 shRNA (UAS, RFP) plasmid
GTR15207997 1 Vial

Lentiviral mouse Prodh2 shRNA (UAS) - Lentiviral mouse Prodh2 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Human ABHD1 Pre-designed siRNA Set A
SI000076A 1 Each

Human ABHD1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
AK5 siRNA (Mouse)
CRN2773-01 15 nmol

AK5 siRNA (Mouse)

Sign In for Pricing
View Details
AK5 siRNA (Mouse)
CRN2773-02 30 nmol

AK5 siRNA (Mouse)

Sign In for Pricing
View Details
MBNL2, CT (MBNL2, MBLL, MBLL39, MLP1, Muscleblind-like protein 2, Muscleblind-like protein 1, Muscleblind-like protein-like, Muscleblind-like protein-like 39) (Azide free) (HRP) discontinued
038247-HRP 200 µL

MBNL2, CT (MBNL2, MBLL, MBLL39, MLP1, Muscleblind-like protein 2, Muscleblind-like protein 1, Muscleblind-like protein-like, Muscleblind-like protein-like 39) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Human RHOC Knockout HEK293T cell line
GTR15416378 1 Vial

Human RHOC Knockout HEK293T cell line

Sign In for Pricing
View Details