Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPIB Rabbit Polyclonal Antibody (HRP)

SPIB Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SPI-B

UniProt

Q01892

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human SPIB

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GQQKGNRKRMTYQKLARALRNYAKTGEIRKVKRKLTYQFDSALLPAVRRA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003112

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EWSR1 (2D11) Mouse Monoclonal antibody
E28PE2552 100 µL

EWSR1 (2D11) Mouse Monoclonal antibody

Sign In for Pricing
View Details
Mouse Low density lipoprotein receptor-related protein 4, LRP4 ELISA Kit
MBS1605258-01 48 Well

Mouse Low density lipoprotein receptor-related protein 4, LRP4 ELISA Kit

Sign In for Pricing
View Details
Mouse Low density lipoprotein receptor-related protein 4, LRP4 ELISA Kit
MBS1605258-02 96 Well

Mouse Low density lipoprotein receptor-related protein 4, LRP4 ELISA Kit

Sign In for Pricing
View Details
Mouse Low density lipoprotein receptor-related protein 4, LRP4 ELISA Kit
MBS1605258-03 5x 96 Well

Mouse Low density lipoprotein receptor-related protein 4, LRP4 ELISA Kit

Sign In for Pricing
View Details
Mouse Low density lipoprotein receptor-related protein 4, LRP4 ELISA Kit
MBS1605258-04 10x 96 Well

Mouse Low density lipoprotein receptor-related protein 4, LRP4 ELISA Kit

Sign In for Pricing
View Details
hsa-miR-548e-3p miRNA Mimic
MCH03019 2x 2.5 nmol

hsa-miR-548e-3p miRNA Mimic

Sign In for Pricing
View Details