Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPIB Rabbit Polyclonal Antibody (HRP)

SPIB Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SPI-B

UniProt

Q01892

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human SPIB

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GQQKGNRKRMTYQKLARALRNYAKTGEIRKVKRKLTYQFDSALLPAVRRA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003112

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Krt19 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7233005 3x 1.0 µg

Krt19 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Axis Inhibition Protein 2 (AXIN2) Porcine ELISA Kit
B7603 96 Tests

Axis Inhibition Protein 2 (AXIN2) Porcine ELISA Kit

Sign In for Pricing
View Details
Human Protein CutA, CUTA ELISA KIT
E5957Hu-01 48 Well

Human Protein CutA, CUTA ELISA KIT

Sign In for Pricing
View Details
Human Protein CutA, CUTA ELISA KIT
E5957Hu-02 96 Well

Human Protein CutA, CUTA ELISA KIT

Sign In for Pricing
View Details
Human Protein CutA, CUTA ELISA KIT
E5957Hu-03 5x 96 Tests

Human Protein CutA, CUTA ELISA KIT

Sign In for Pricing
View Details
Human Protein CutA, CUTA ELISA KIT
E5957Hu-04 10x 96 Tests

Human Protein CutA, CUTA ELISA KIT

Sign In for Pricing
View Details