Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXB5 Rabbit Polyclonal Antibody (FITC)

HOXB5 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HOX2, HU-1, HOX2A, Hox2.1, HHO.C10

UniProt

P09067

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HOXB5

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MSSYFVNSFSGRYPNGPDYQLLNYGSGSSLSGSYRDPAAMHTGSYGYNYN

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_002138

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIAA1107 Rabbit Polyclonal Antibody (Biotin)
orb450606 100 µL

KIAA1107 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Lentiviral human HOXA1 shRNA (UAS) - Lentiviral human HOXA1 shRNA (UAS, iRFP) plasmid
GTR15155512 1 Vial

Lentiviral human HOXA1 shRNA (UAS) - Lentiviral human HOXA1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Lentiviral human GABRR1 sgRNA gene knockout kit - Lentiviral human GABRR1 sgRNA gene knockout kit (25)
GTR15389667 1 Vial

Lentiviral human GABRR1 sgRNA gene knockout kit - Lentiviral human GABRR1 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Cat Cytochrome P450 1A1 (CYP1A1) ELISA Kit
MBS284188-01 48 Tests

Cat Cytochrome P450 1A1 (CYP1A1) ELISA Kit

Sign In for Pricing
View Details
Cat Cytochrome P450 1A1 (CYP1A1) ELISA Kit
MBS284188-02 96 Tests

Cat Cytochrome P450 1A1 (CYP1A1) ELISA Kit

Sign In for Pricing
View Details
Cat Cytochrome P450 1A1 (CYP1A1) ELISA Kit
MBS284188-03 5x 96 Tests

Cat Cytochrome P450 1A1 (CYP1A1) ELISA Kit

Sign In for Pricing
View Details