Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF883 Rabbit Polyclonal Antibody (HRP)

ZNF883 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

P0CG24

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZNF883

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YQCNECGKSFSLSSALTKHKRIHTRERPYQCTKCGDVFCHSTSLIRHQKT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human

Tested Applications

WB

NCBI Accession Number

NP_001094808

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Soluble programmed death 1 ELISA kit
GTR10422825 96 Well

Monkey Soluble programmed death 1 ELISA kit

Sign In for Pricing
View Details
Hamster Carbonic Anhydrase III, Muscle Specific ELISA Kit
MBS060291-01 48 Well

Hamster Carbonic Anhydrase III, Muscle Specific ELISA Kit

Sign In for Pricing
View Details
Hamster Carbonic Anhydrase III, Muscle Specific ELISA Kit
MBS060291-02 96 Well

Hamster Carbonic Anhydrase III, Muscle Specific ELISA Kit

Sign In for Pricing
View Details
Hamster Carbonic Anhydrase III, Muscle Specific ELISA Kit
MBS060291-03 5x 96 Well

Hamster Carbonic Anhydrase III, Muscle Specific ELISA Kit

Sign In for Pricing
View Details
Hamster Carbonic Anhydrase III, Muscle Specific ELISA Kit
MBS060291-04 10x 96 Well

Hamster Carbonic Anhydrase III, Muscle Specific ELISA Kit

Sign In for Pricing
View Details
IL17C Antibody
orb1261387 100 µL

IL17C Antibody

Sign In for Pricing
View Details