Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAD51 Rabbit Polyclonal Antibody (HRP)

RAD51 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RECA, BRCC5, FANCR, MRMV2, HRAD51, RAD51A, HsRad51, HsT16930

UniProt

Q06609

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human RAD51

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYA

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS26P47 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV784532 1.0 µg DNA

RPS26P47 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
ILEU Antibody - middle region (ARP74211_P050)
ARP74211_P050 100 µL

ILEU Antibody - middle region (ARP74211_P050)

Sign In for Pricing
View Details
Human EDIL3 Protein, Fc Tag
ED3-H5259-100ug 100 µg

Human EDIL3 Protein, Fc Tag

Sign In for Pricing
View Details
C2orf42 Peptide
orb2013461 100 µg

C2orf42 Peptide

Sign In for Pricing
View Details
Rabbit Polyclonal SCD-2 Antibody
NBP3-10121-100ul 100 µL

Rabbit Polyclonal SCD-2 Antibody

Sign In for Pricing
View Details
Human IL-17A/F Heterodimer ELISA Kit (Colorimetric)
NBP3-14633 1 Kit

Human IL-17A/F Heterodimer ELISA Kit (Colorimetric)

Sign In for Pricing
View Details