Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SSBP2 Rabbit Polyclonal Antibody (Biotin)

SSBP2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HSPC116, SOSS-B2

UniProt

P81877

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SSBP2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YPGGPRPPLRIPNQALGGVPGSQPLLPSGMDPTRQQGHPNMGGPMQRMTP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_036578

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SPATA46 Mouse Monoclonal Antibody [Clone ID: OTI2A9]
M31943 100 µL

Anti-SPATA46 Mouse Monoclonal Antibody [Clone ID: OTI2A9]

Sign In for Pricing
View Details
NR2F2, NT (NR2F2, ARP1, TFCOUP2, COUP transcription factor 2, Apolipoprotein A-I regulatory protein 1, COUP transcription factor II, Nuclear receptor subfamily 2 group F member 2) (APC)
MBS6326601-01 0.2 mL

NR2F2, NT (NR2F2, ARP1, TFCOUP2, COUP transcription factor 2, Apolipoprotein A-I regulatory protein 1, COUP transcription factor II, Nuclear receptor subfamily 2 group F member 2) (APC)

Sign In for Pricing
View Details
NR2F2, NT (NR2F2, ARP1, TFCOUP2, COUP transcription factor 2, Apolipoprotein A-I regulatory protein 1, COUP transcription factor II, Nuclear receptor subfamily 2 group F member 2) (APC)
MBS6326601-02 5x 0.2 mL

NR2F2, NT (NR2F2, ARP1, TFCOUP2, COUP transcription factor 2, Apolipoprotein A-I regulatory protein 1, COUP transcription factor II, Nuclear receptor subfamily 2 group F member 2) (APC)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Indoleamine 2,3-dioxygenase family protein (BNA2)
MBS1245979-01 0.02 mg (E-Coli)

Recombinant Saccharomyces cerevisiae Indoleamine 2,3-dioxygenase family protein (BNA2)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Indoleamine 2,3-dioxygenase family protein (BNA2)
MBS1245979-02 0.02 mg (Yeast)

Recombinant Saccharomyces cerevisiae Indoleamine 2,3-dioxygenase family protein (BNA2)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Indoleamine 2,3-dioxygenase family protein (BNA2)
MBS1245979-03 0.1 mg (E-Coli)

Recombinant Saccharomyces cerevisiae Indoleamine 2,3-dioxygenase family protein (BNA2)

Sign In for Pricing
View Details