Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF620 Rabbit Polyclonal Antibody (HRP)

ZNF620 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q6ZNG0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF620

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TVHQRMHTGEKPYECKECGKRLSSNTALTQHQRIHTGEKPFECKECGKAF

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_787084

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Protein phosphatase 1 ELISA Kit
MBS7275292-01 48 Well

Chicken Protein phosphatase 1 ELISA Kit

Sign In for Pricing
View Details
Chicken Protein phosphatase 1 ELISA Kit
MBS7275292-02 96 Well

Chicken Protein phosphatase 1 ELISA Kit

Sign In for Pricing
View Details
Chicken Protein phosphatase 1 ELISA Kit
MBS7275292-03 5x 96 Well

Chicken Protein phosphatase 1 ELISA Kit

Sign In for Pricing
View Details
Chicken Protein phosphatase 1 ELISA Kit
MBS7275292-04 10x 96 Well

Chicken Protein phosphatase 1 ELISA Kit

Sign In for Pricing
View Details
LRRC15, Cynomolgus/Rhesus macaque (HEK293, Fc)
HY-P704768 100 µg

LRRC15, Cynomolgus/Rhesus macaque (HEK293, Fc)

Sign In for Pricing
View Details
PSD3 Peptide
DF13807-BP 1 mg

PSD3 Peptide

Sign In for Pricing
View Details