Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPDEF Rabbit Polyclonal Antibody (FITC)

SPDEF Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PDEF, bA375E1.3

UniProt

O95238

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SPDEF

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AAAGAVGLERRDWSPSPPATPEQGLSAFYLSYFDMLYPEDSSWAAKAPGA

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_036523

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GCN2 (EIF2AK4) Rabbit Polyclonal Antibody
TA375792 100 µL

GCN2 (EIF2AK4) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Clear Weld Heat Seal, optically clear heat sealing film, 100 sheets (125 x 78mm) per case
4TI-0575 100 Sheets (125 x 78 mm)

Clear Weld Heat Seal, optically clear heat sealing film, 100 sheets (125 x 78mm) per case

Sign In for Pricing
View Details
Recombinant Human OX40/TNFRSF4 Protein (mFc Tag)
PKSH033789-01 10 µg

Recombinant Human OX40/TNFRSF4 Protein (mFc Tag)

Sign In for Pricing
View Details
Recombinant Human OX40/TNFRSF4 Protein (mFc Tag)
PKSH033789-02 50 µg

Recombinant Human OX40/TNFRSF4 Protein (mFc Tag)

Sign In for Pricing
View Details
RET V804M-IN-1
MBS3611934-01 2 mg

RET V804M-IN-1

Sign In for Pricing
View Details
RET V804M-IN-1
MBS3611934-02 5 mg

RET V804M-IN-1

Sign In for Pricing
View Details