Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF545 Rabbit Polyclonal Antibody (Biotin)

ZNF545 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ZNF545

UniProt

Q8N141

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF545

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KAFSRYSQLISHQSIHIGVKPYDCKECGKAFRLLSQLTQHQSIHIGEKPY

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_597723

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNK10, CT (KCNK10, TREK2, Potassium channel subfamily K member 10, Outward rectifying potassium channel protein TREK-2, TREK-2 K(+) channel subunit) (PE)
MBS6312631-01 0.2 mL

KCNK10, CT (KCNK10, TREK2, Potassium channel subfamily K member 10, Outward rectifying potassium channel protein TREK-2, TREK-2 K(+) channel subunit) (PE)

Sign In for Pricing
View Details
KCNK10, CT (KCNK10, TREK2, Potassium channel subfamily K member 10, Outward rectifying potassium channel protein TREK-2, TREK-2 K(+) channel subunit) (PE)
MBS6312631-02 5x 0.2 mL

KCNK10, CT (KCNK10, TREK2, Potassium channel subfamily K member 10, Outward rectifying potassium channel protein TREK-2, TREK-2 K(+) channel subunit) (PE)

Sign In for Pricing
View Details
Mouse Annexin A5 (ANXA5) ELISA Kit
orb775514-01 48 Tests

Mouse Annexin A5 (ANXA5) ELISA Kit

Sign In for Pricing
View Details
Mouse Annexin A5 (ANXA5) ELISA Kit
orb775514-02 96 Tests

Mouse Annexin A5 (ANXA5) ELISA Kit

Sign In for Pricing
View Details
Ethyl 5-amino-4-cyanoisoxazole-3-carboxylate
WDA12939-01 50 mg

Ethyl 5-amino-4-cyanoisoxazole-3-carboxylate

Sign In for Pricing
View Details
Ethyl 5-amino-4-cyanoisoxazole-3-carboxylate
WDA12939-02 0.5 g

Ethyl 5-amino-4-cyanoisoxazole-3-carboxylate

Sign In for Pricing
View Details