Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR13C9 Rabbit Polyclonal Antibody (HRP)

OR13C9 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OR37L, OR9-13

UniProt

Q8NGT0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human OR13C9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IFYGTILFMYMKPKSKETLNSDDLDATDKIISMFYGVMTPMMNPLIYSLR

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_001001956

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VLDL Receptor Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-21401R-BF750 100 µL

VLDL Receptor Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
C-Met Antibody
E38PA4735 100 µL

C-Met Antibody

Sign In for Pricing
View Details
Anti-SARM1 Antibody Picoband® Fluoro550 Conjugated
A03633-2-Fluoro550 100 µg/Vial

Anti-SARM1 Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
PRAMEF17 Human Over-expression Lysate
orb1341478 100 µg

PRAMEF17 Human Over-expression Lysate

Sign In for Pricing
View Details
TSPAN7 Antibody
MBS9020861 0.1 mL

TSPAN7 Antibody

Sign In for Pricing
View Details
Adrenal gland tumor tissue array, including pathology grade, TNM and clinical stage, 80 cases/160 cores
EAG1601 80 Cases / 160 Cores

Adrenal gland tumor tissue array, including pathology grade, TNM and clinical stage, 80 cases/160 cores

Sign In for Pricing
View Details