Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hoxb9 Rabbit Polyclonal Antibody (HRP)

Hoxb9 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SEDAPPAKFPSGQYANPRQPGHAEHLDFPSCSFQPKAPVFGASWAPLSPH

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001093967

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rgs9bp ORF Vector (Mouse) (pORF)
ORF055982 1.0 µg DNA

Rgs9bp ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Zfp111 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7047408 1.0 µg DNA

Zfp111 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
4- (3-Methoxypropyl) -1-oxa-4,9-diazaspiro[5.5]undecan-3-one
OR1044633 250 mg

4- (3-Methoxypropyl) -1-oxa-4,9-diazaspiro[5.5]undecan-3-one

Sign In for Pricing
View Details
NCALD Rabbit Polyclonal Antibody
orb185645-01 50 μL

NCALD Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NCALD Rabbit Polyclonal Antibody
orb185645-02 100 µL

NCALD Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NCALD Rabbit Polyclonal Antibody
orb185645-03 200 µL

NCALD Rabbit Polyclonal Antibody

Sign In for Pricing
View Details