Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFAP2E Rabbit Polyclonal Antibody (HRP)

TFAP2E Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AP2E, AP-2epsilon

UniProt

Q6VUC0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TFAP2E

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MLVHTYSAMERPDGLGAAAGGARLSSLPQAAYGPAPPLCHTPAATAAAEF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse

Tested Applications

WB

NCBI Accession Number

NP_848643

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AP2 gamma Rabbit Polyclonal Antibody (RBITC)
orb1041340 100 µL

AP2 gamma Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
Lentiviral mouse Hsdl1 shRNA (UAS) - Lentiviral mouse Hsdl1 shRNA (UAS, RFP) (25)
GTR15194579 1 Vial

Lentiviral mouse Hsdl1 shRNA (UAS) - Lentiviral mouse Hsdl1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Camel 5'-3' Exoribonuclease 2 (XRN2) ELISA Kit
MBS9918575-01 48 Well

Camel 5'-3' Exoribonuclease 2 (XRN2) ELISA Kit

Sign In for Pricing
View Details
Camel 5'-3' Exoribonuclease 2 (XRN2) ELISA Kit
MBS9918575-02 96 Well

Camel 5'-3' Exoribonuclease 2 (XRN2) ELISA Kit

Sign In for Pricing
View Details
Camel 5'-3' Exoribonuclease 2 (XRN2) ELISA Kit
MBS9918575-03 5x 96 Well

Camel 5'-3' Exoribonuclease 2 (XRN2) ELISA Kit

Sign In for Pricing
View Details
Camel 5'-3' Exoribonuclease 2 (XRN2) ELISA Kit
MBS9918575-04 10x 96 Well

Camel 5'-3' Exoribonuclease 2 (XRN2) ELISA Kit

Sign In for Pricing
View Details