Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aff1 Rabbit Polyclonal Antibody (Biotin)

Aff1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

R, Af, Af4, Rob, Mllt, Mllt2h, AW319193, 9630032B01Rik

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MAAHSSLYNEDRNLLRIREKERRNQEAHQEKEAFPEKAPLFPEPYKTAKG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

132kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_598680

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL-25/IL-17E[Biotin], His & Avi, Human
Z04511-500 500 µg

IL-25/IL-17E[Biotin], His & Avi, Human

Sign In for Pricing
View Details
Recombinant Polaromonas naphthalenivorans NADH-quinone oxidoreductase subunit A (nuoA)
MBS7023788-01 0.02 mg

Recombinant Polaromonas naphthalenivorans NADH-quinone oxidoreductase subunit A (nuoA)

Sign In for Pricing
View Details
Recombinant Polaromonas naphthalenivorans NADH-quinone oxidoreductase subunit A (nuoA)
MBS7023788-02 0.1 mg

Recombinant Polaromonas naphthalenivorans NADH-quinone oxidoreductase subunit A (nuoA)

Sign In for Pricing
View Details
Recombinant Polaromonas naphthalenivorans NADH-quinone oxidoreductase subunit A (nuoA)
MBS7023788-03 5x 0.1 mg

Recombinant Polaromonas naphthalenivorans NADH-quinone oxidoreductase subunit A (nuoA)

Sign In for Pricing
View Details
TSC1, Phosphorylated (S561) (Tsc1, Kiaa0243, Hamartin, Tuberous sclerosis 1 protein homolog) (MaxLight 750)
MBS6359065-01 0.1 mL

TSC1, Phosphorylated (S561) (Tsc1, Kiaa0243, Hamartin, Tuberous sclerosis 1 protein homolog) (MaxLight 750)

Sign In for Pricing
View Details
TSC1, Phosphorylated (S561) (Tsc1, Kiaa0243, Hamartin, Tuberous sclerosis 1 protein homolog) (MaxLight 750)
MBS6359065-02 5x 0.1 mL

TSC1, Phosphorylated (S561) (Tsc1, Kiaa0243, Hamartin, Tuberous sclerosis 1 protein homolog) (MaxLight 750)

Sign In for Pricing
View Details