Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aff1 Rabbit Polyclonal Antibody (Biotin)

Aff1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

R, Af, Af4, Rob, Mllt, Mllt2h, AW319193, 9630032B01Rik

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MAAHSSLYNEDRNLLRIREKERRNQEAHQEKEAFPEKAPLFPEPYKTAKG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

132kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_598680

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nori® Monkey MMP-14 ELISA Kit
GR169150 96 Well

Nori® Monkey MMP-14 ELISA Kit

Sign In for Pricing
View Details
Aimp2 Mouse Pre-designed siRNA Set A
HY-RS20364 1 Set

Aimp2 Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
H1N1 Nucleoprotein Rabbit Polyclonal Antibody (HRP)
orb482011 100 µL

H1N1 Nucleoprotein Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
KAL1 (ADMLX, KAL, KALIG1, Anosmin-1, Adhesion Molecule-like X-linked, Kallmann Syndrome Protein) (MaxLight 750) discontinued
128706-ML750 100 µL

KAL1 (ADMLX, KAL, KALIG1, Anosmin-1, Adhesion Molecule-like X-linked, Kallmann Syndrome Protein) (MaxLight 750) discontinued

Sign In for Pricing
View Details
WJD008
HY-116191 1 Each

WJD008

Sign In for Pricing
View Details
Anti-TNF Receptor I/TNFRSF1A Antibody Picoband®, PE Conjugate
PA1210-PE 100 µg/Vial

Anti-TNF Receptor I/TNFRSF1A Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details