Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOXO6 Rabbit Polyclonal Antibody (HRP)

FOXO6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

A8MYZ6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FOXO6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LSYADLITKAIESAPDKRLTLSQIYDWMVRYVPYFKDKGDSNSSAGWKNS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD90 Recombinant Rabbit mAb
BS46337-01 50 µL

CD90 Recombinant Rabbit mAb

Sign In for Pricing
View Details
CD90 Recombinant Rabbit mAb
BS46337-02 100 µL

CD90 Recombinant Rabbit mAb

Sign In for Pricing
View Details
GSTK1, Human (GST)
HY-P700381 1 Each

GSTK1, Human (GST)

Sign In for Pricing
View Details
Rat RAS guanyl-releasing protein 2, RASGRP2 ELISA Kit
MBS9327732-01 48 Well

Rat RAS guanyl-releasing protein 2, RASGRP2 ELISA Kit

Sign In for Pricing
View Details
Rat RAS guanyl-releasing protein 2, RASGRP2 ELISA Kit
MBS9327732-02 96 Well

Rat RAS guanyl-releasing protein 2, RASGRP2 ELISA Kit

Sign In for Pricing
View Details
Rat RAS guanyl-releasing protein 2, RASGRP2 ELISA Kit
MBS9327732-03 5x 96 Well

Rat RAS guanyl-releasing protein 2, RASGRP2 ELISA Kit

Sign In for Pricing
View Details