Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pik3r1 Rabbit Polyclonal Antibody (HRP)

Pik3r1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PI, p50, p55, p85, PI3K, p50alpha, p55alpha, p85alpha

UniProt

Q80UI5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HEYNTQFQEKSREYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCQ

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001020126

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rpl38 (NM_001048058) Mouse Tagged ORF Clone
MG200076 10 µg

Rpl38 (NM_001048058) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Phospho-RSK1 p90 (T359 + S363) Recombinant Rabbit Monoclonal Antibody [SU03-65]
ET1608-53 100 µL

Phospho-RSK1 p90 (T359 + S363) Recombinant Rabbit Monoclonal Antibody [SU03-65]

Sign In for Pricing
View Details
DOG-1 (DG1/447), CF740 conjugate, 0.1mg/mL
BNC740447-500 1x 500 µL

DOG-1 (DG1/447), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PF 431396
TRC-P218290-50MG 50 mg

PF 431396

Sign In for Pricing
View Details
KCTD9 (NM_017634) Human Recombinant Protein
TP309801 20 µg

KCTD9 (NM_017634) Human Recombinant Protein

Sign In for Pricing
View Details
C13orf31 (LACC1) (NM_001128303) Human Over-expression Lysate
LC426942 20 µg

C13orf31 (LACC1) (NM_001128303) Human Over-expression Lysate

Sign In for Pricing
View Details