Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF706 Rabbit Polyclonal Antibody (HRP)

ZNF706 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HSPC038, PNAS-106, PNAS-113

UniProt

Q9Y5V0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF706

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQMPDP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

8kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057180

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Amino-3-bromo-5-chlorobenzoic acid
OR46070-01 1 g

2-Amino-3-bromo-5-chlorobenzoic acid

Sign In for Pricing
View Details
2-Amino-3-bromo-5-chlorobenzoic acid
OR46070-02 5 g

2-Amino-3-bromo-5-chlorobenzoic acid

Sign In for Pricing
View Details
2-Amino-3-bromo-5-chlorobenzoic acid
OR46070-03 10 g

2-Amino-3-bromo-5-chlorobenzoic acid

Sign In for Pricing
View Details
SHP-1, Recombinant, Human (Tyrosine-protein Phosphatase Non-receptor type 6, EC 3.1.3.48, Protein-tyrosine Phosphatase 1C, PTP-1C, Hematopoietic Cell Protein-tyrosine Phosphatase, SH- PTP1, Protein-tyrosine Phosphatase SHP-1, PTPN6, HCP, HCPH, SHP1, HPTP1C, SHP-1L) discontinued
209203 5 µg

SHP-1, Recombinant, Human (Tyrosine-protein Phosphatase Non-receptor type 6, EC 3.1.3.48, Protein-tyrosine Phosphatase 1C, PTP-1C, Hematopoietic Cell Protein-tyrosine Phosphatase, SH- PTP1, Protein-tyrosine Phosphatase SHP-1, PTPN6, HCP, HCPH, SHP1, HPTP1C, SHP-1L) discontinued

Sign In for Pricing
View Details
BFSP2 Mouse Monoclonal Antibody [Clone ID: LBI4D3]
AMM16445V 100 µL

BFSP2 Mouse Monoclonal Antibody [Clone ID: LBI4D3]

Sign In for Pricing
View Details
Anti-IL22 Antibody Picoband® (monoclonal, 7F2) Fluoro488 Conjugated
M00963-Fluoro488 100 µg/Vial

Anti-IL22 Antibody Picoband® (monoclonal, 7F2) Fluoro488 Conjugated

Sign In for Pricing
View Details