Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NT5C3 Rabbit Polyclonal Antibody (Biotin)

NT5C3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P36, PN-I, POMP, PSN1, UMPH, NT5C3, P5N-1, UMPH1, hUMP1, P5'N-1, cN-III

UniProt

Q9H0P0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NT5C3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNII

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057573

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZFAND5 Rabbit pAb
orb2718820-01 50 µL

ZFAND5 Rabbit pAb

Sign In for Pricing
View Details
ZFAND5 Rabbit pAb
orb2718820-02 100 µL

ZFAND5 Rabbit pAb

Sign In for Pricing
View Details
Polyclonal Antibody to Fibroblast Growth Factor 13 (FGF13)
TRV-0058493-01 20 µL

Polyclonal Antibody to Fibroblast Growth Factor 13 (FGF13)

Sign In for Pricing
View Details
Polyclonal Antibody to Fibroblast Growth Factor 13 (FGF13)
TRV-0058493-02 100 µL

Polyclonal Antibody to Fibroblast Growth Factor 13 (FGF13)

Sign In for Pricing
View Details
Polyclonal Antibody to Fibroblast Growth Factor 13 (FGF13)
TRV-0058493-03 200 µL

Polyclonal Antibody to Fibroblast Growth Factor 13 (FGF13)

Sign In for Pricing
View Details
Polyclonal Antibody to Fibroblast Growth Factor 13 (FGF13)
TRV-0058493-04 1 mL

Polyclonal Antibody to Fibroblast Growth Factor 13 (FGF13)

Sign In for Pricing
View Details