Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AHR Rabbit Polyclonal Antibody (Biotin)

AHR Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RP85, bHLHe76

UniProt

P35869

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human AHR

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RAKSFFDVALKSSPTERNGGQDNCRAANFREGLNLQEGEFLLQALNGFVL

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

96kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

IHC, WB

NCBI Accession Number

NP_001612

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AK3P4 Recombinant Protein (Human)
RP046252 100 µg

AK3P4 Recombinant Protein (Human)

Sign In for Pricing
View Details
Mouse S100B (S100 Calcium Binding Protein B) ELISA Kit
MBS8801826-01 48 Well

Mouse S100B (S100 Calcium Binding Protein B) ELISA Kit

Sign In for Pricing
View Details
Mouse S100B (S100 Calcium Binding Protein B) ELISA Kit
MBS8801826-02 96 Well

Mouse S100B (S100 Calcium Binding Protein B) ELISA Kit

Sign In for Pricing
View Details
Mouse S100B (S100 Calcium Binding Protein B) ELISA Kit
MBS8801826-03 5x 96 Well

Mouse S100B (S100 Calcium Binding Protein B) ELISA Kit

Sign In for Pricing
View Details
Mouse S100B (S100 Calcium Binding Protein B) ELISA Kit
MBS8801826-04 10x 96 Well

Mouse S100B (S100 Calcium Binding Protein B) ELISA Kit

Sign In for Pricing
View Details
Bovine Chondroitin Sulfate Epitope 3B3 ELISA Kit
MBS742169-01 48 Well

Bovine Chondroitin Sulfate Epitope 3B3 ELISA Kit

Sign In for Pricing
View Details