Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ID4 Rabbit Polyclonal Antibody (Biotin)

ID4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

IDB4, bHLHb27

UniProt

P47928

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ID4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

16kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001537

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Oga shRNA (UAS) - Lentiviral mouse Oga shRNA (UAS, GFP) plasmid
GTR15190474 1 Vial

Lentiviral mouse Oga shRNA (UAS) - Lentiviral mouse Oga shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
DNA-directed RNA polymerase III subunit RPC3
313720-01 50 µg

DNA-directed RNA polymerase III subunit RPC3

Sign In for Pricing
View Details
DNA-directed RNA polymerase III subunit RPC3
313720-02 100 µg

DNA-directed RNA polymerase III subunit RPC3

Sign In for Pricing
View Details
G-protein coupled Receptor 98 (GPR98) Mouse ELISA Kit
D5579 96 Tests

G-protein coupled Receptor 98 (GPR98) Mouse ELISA Kit

Sign In for Pricing
View Details
SARS-CoV-2 Spike P26S Peptide (Gamma Variant)
orb1231659 0.05 mg

SARS-CoV-2 Spike P26S Peptide (Gamma Variant)

Sign In for Pricing
View Details
3-Iodo-1-methyl-1h-indazole-5-carboxylic acid ethyl ester
426098-01 25 mg

3-Iodo-1-methyl-1h-indazole-5-carboxylic acid ethyl ester

Sign In for Pricing
View Details