Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMD4 Rabbit Polyclonal Antibody (HRP)

PSMD4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AF, ASF, S5A, AF-1, MCB1, Rpn10, pUB-R5

UniProt

P55036

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PSMD4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VAHLALKHRQGKNHKMRIIAFVGSPVEDNEKDLVKLAKRLKKEKVNVDII

Field of Research

Cancer Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002801

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LATS1 (N) Antibody, Rabbit Polyclonal
orb386732 100 µL

LATS1 (N) Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
BRD9 Rabbit Polyclonal Antibody
TA338343 100 µL

BRD9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SPINK4 Human shRNA Plasmid Kit (Locus ID 27290)
TR318836 1 Kit

SPINK4 Human shRNA Plasmid Kit (Locus ID 27290)

Sign In for Pricing
View Details
PRKD1 sgRNA CRISPR Lentivector (Human) (Target 3)
K1722504 1.0 µg DNA

PRKD1 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Mouse Monoclonal XPF Antibody (OTI3H7) [mFluor Violet 500 SE]
NBP2-74882MFV500 0.1 mL

Mouse Monoclonal XPF Antibody (OTI3H7) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
WNT7A Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-25183R-BF350 100 µL

WNT7A Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details