Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBX19 Rabbit Polyclonal Antibody (HRP)

TBX19 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TPIT, TBS19, dJ747L4.1

UniProt

O60806

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TBX19

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KPSDGTVSHLLNVVESELQAGREKGDPTEKQLQIILEDAPLWQRFKEVTN

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_005140

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp943 Mouse Gene Knockout Kit (CRISPR)
KN520038 1 Kit

Zfp943 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Hexakis[μ-(Acetato-κO:κO')]triaqua-μ3-oxotri-iridium(1+) Acetate
TRC-I766015-25MG 25 mg

Hexakis[μ-(Acetato-κO:κO')]triaqua-μ3-oxotri-iridium(1+) Acetate

Sign In for Pricing
View Details
RAD51 (Prognostic and Response to Chemotherapy Marker) (RAD51/2765), CF405S conjugate, 0.1mg/mL
BNC042765-500 1x 500 µL

RAD51 (Prognostic and Response to Chemotherapy Marker) (RAD51/2765), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Gastrin (GAST/2632), CF740 conjugate, 0.1mg/mL
BNC742632-500 1x 500 µL

Gastrin (GAST/2632), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 Recombinant Rabbit monoclonal Antibody [SJ20-00]
ET1606-50-50UL 50 µL

CD86 Recombinant Rabbit monoclonal Antibody [SJ20-00]

Sign In for Pricing
View Details
Human LOC100288966 activation kit by CRISPRa
GA119241 1 Kit

Human LOC100288966 activation kit by CRISPRa

Sign In for Pricing
View Details