Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBX19 Rabbit Polyclonal Antibody (HRP)

TBX19 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TPIT, TBS19, dJ747L4.1

UniProt

O60806

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TBX19

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KPSDGTVSHLLNVVESELQAGREKGDPTEKQLQIILEDAPLWQRFKEVTN

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_005140

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBX3 Rabbit Polyclonal Antibody
TA382356 100 µL

TBX3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SARS-CoV-2 Nucleocapsid protein Mouse Monoclonal Antibody [A5B10] - BSA and Azide free (Capture)
HA600007 100 µg

SARS-CoV-2 Nucleocapsid protein Mouse Monoclonal Antibody [A5B10] - BSA and Azide free (Capture)

Sign In for Pricing
View Details
KDM1A (Center) Rabbit Polyclonal Antibody
AP11212PU-N 400 µL

KDM1A (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (rIG266), CF568 conjugate, 0.1mg/mL
BNC681789-100 1x 100 µL

Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (rIG266), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human LILRA3 activation kit by CRISPRa
GA107576 1 Kit

Human LILRA3 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Bone: femur
CS716944 5x 5 µm

Tissue FFPE Sections, Bone: femur

Sign In for Pricing
View Details